PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013622117.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 255aa    MW: 28630.2 Da    PI: 7.825
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013622117.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.52.6e-072873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                      WT+eE + + +a + +  +   +W +Ia++++ g+t  ++   + k
   XP_013622117.1 28 VWTKEENKMFERALAIYAEDspdRWFSIASMIP-GKTVFDVMKQYSK 73
                     7*****************99*************.***9999888876 PP

2Myb_DNA-binding38.82.2e-12124168347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT eE+ +++ +  ++G+g+W+ I+r +   +t+ q+ s+ qky
   XP_013622117.1 124 PWTDEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 168
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.6492477IPR017884SANT domain
SMARTSM007178.0E-82577IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-42673IPR009057Homeodomain-like
SuperFamilySSF466893.3E-112781IPR009057Homeodomain-like
PfamPF002496.9E-62873IPR001005SANT/Myb domain
CDDcd001671.57E-72974No hitNo description
PROSITE profilePS5129418.612117173IPR017930Myb domain
SuperFamilySSF466891.42E-15119172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-17120172IPR006447Myb domain, plants
SMARTSM007177.8E-10121171IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-10121168IPR009057Homeodomain-like
CDDcd001671.05E-8124168No hitNo description
PfamPF002491.4E-9124168IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
METLHPLSHV PISDNRFVVQ DMMSSSSVWT KEENKMFERA LAIYAEDSPD RWFSIASMIP  60
GKTVFDVMKQ YSKLEEDVSD IEAGRVPIPG YPSASSPLGF EPDTCRKRPS GGRGSDHDRK  120
KGVPWTDEEH RRFLLGLLKY GKGDWRNISR NFVVSKTPTQ VASHAQKYYL RQLSGAKDKR  180
RPSIHDFTTV NLINANLNRS ISDHRDILPD LGFVDKDGAE EGLMFLSQNH MFSPSSSPFD  240
AAVRFAGANA FSATS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-1629911173RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00347DAPTransfer from AT3G11280Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013622117.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-74DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3AEH70.0A0A0D3AEH7_BRAOL; Uncharacterized protein
STRINGBra034173.1-P1e-179(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM43402657
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-160MYB family protein